PDB entry 2k1x

View 2k1x on RCSB PDB site
Description: NMR solution structure of M-crystallin in calcium free form (apo).
Class: metal binding protein
Keywords: crystallin, eye lens, archaea, cataract, evolution, METAL BINDING PROTEIN
Deposited on 2008-03-17, released 2009-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-10, with a file datestamp of 2009-03-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta/gama crystallin family protein
    Species: METHANOSARCINA ACETIVORANS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TMX3 (1-84)
      • expression tag (0)
    Domains in SCOPe 2.08: d2k1xa1, d2k1xa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k1xA (A:)
    mnaaevivyehvnfggksfdatsdqpgagdnlndkissikvksgtwrfyeyinyggrywd
    lgpgeyssvesagipdnsissfrqi