PDB entry 2k1m

View 2k1m on RCSB PDB site
Description: 3D NMR structure of domain cC0 of cardiac myosin binding protein C (MyBPC)
Class: structural protein
Keywords: Ig-I domain, Myosin Binding Protein C, Cardiac Muscle, Hypertrophic cardiomyopathy, Actin-binding, Cell adhesion, Disease mutation, Immunoglobulin domain, Muscle protein, Phosphoprotein, Polymorphism, Thick filament, STRUCTURAL PROTEIN
Deposited on 2008-03-10, released 2009-03-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-03-17, with a file datestamp of 2009-03-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-binding protein C, cardiac-type
    Species: Homo sapiens [TaxId:9606]
    Gene: MYBPC3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2k1ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k1mA (A:)
    pepgkkpvsafskkprsvevaagspavfeaeteragvkvrwqrggsdisasnkyglateg
    trhtltvrevgpadqgsyaviagsskvkfdlkvie