PDB entry 2k1c

View 2k1c on RCSB PDB site
Description: NMR Structure of the C-terminal domain of HIV-1 Capsid in complex with peptide Inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: alpha-helix, hydrocarbon stapling, AIDS, Aspartyl protease, Capsid maturation, Capsid protein, DNA integration, DNA recombination, DNA-directed DNA polymerase, Endonuclease, Lipoprotein, Magnesium, Membrane, Metal-binding, Multifunctional enzyme, Myristate, Nuclease, Nucleotidyltransferase, Nucleus, Phosphoprotein, Protease, RNA-binding, RNA-directed DNA polymerase, Transferase, Viral nucleoprotein, Virion, Zinc-finger, VIRAL PROTEIN, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2008-02-29, released 2008-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-29, with a file datestamp of 2010-12-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35963 (21-104)
      • engineered (57-58)
    Domains in SCOPe 2.07: d2k1ca_
  • Chain 'B':
    Compound: NYAD-13 peptide inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 2K1C (0-9)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2k1cA (A:)
    mgsshhhhhhssglvprgshmtsildirqgpkepfrdyvdrfyktlraeqasqevknaat
    etllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2k1cA (A:)
    tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
    aatleemmtacqgvggpghkarvl
    

  • Chain 'B':
    No sequence available.