PDB entry 2k1b

View 2k1b on RCSB PDB site
Description: Solution NMR structure of the chromo domain of the chromobox protein homolog 7
Class: transcription regulator
Keywords: alpha/beta protein, Chromatin regulator, Nucleus, Repressor, Transcription, Transcription regulation, Structural Genomics Consortium, SGC, TRANSCRIPTION REGULATOR
Deposited on 2008-02-25, released 2008-03-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromobox protein homolog 7
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2k1ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2k1bA (A:)
    mhhhhhhssgrenlyfqgeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehil
    dprlvmayeekee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2k1bA (A:)
    eqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekee