PDB entry 2k0g

View 2k0g on RCSB PDB site
Description: Solution Structure of a Bacterial Cyclic Nucleotide-Activated K+ Channel Binding Domain in Complex with cAMP
Class: membrane protein
Keywords: Membrane Protein, Ion Channel, helical bundle beta barrel core, Phosphate Binding Cassette with cAMP bound, Cyclic Nucleotide Binding Domain, Solution Structure
Deposited on 2008-02-02, released 2009-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-14, with a file datestamp of 2009-07-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Mll3241 protein
  Species: Rhizobium loti
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q98GN8 (2-141)
    • expression tag (0-1)
  Domains in SCOPe 2.07: d2k0ga1, d2k0ga2
• Heterogens: CMP

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k0gA (A:)
  gsqevrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmf
  fvvegsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcss
  speiaeifrktalerrgaaasa