PDB entry 2k0c

View 2k0c on RCSB PDB site
Description: Zinc-finger 2 of Nup153
Class: metal binding protein
Keywords: Zinc-Finger, DNA-binding, Metal-binding, mRNA transport, Nuclear pore complex, Nucleus, Phosphoprotein, Protein transport, Translocation, Transport, METAL BINDING PROTEIN
Deposited on 2008-01-31, released 2008-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear pore complex protein Nup153
    Species: Rattus norvegicus
    Gene: NUP153
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2k0ca_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2k0cA (A:)
    sdkpastsgtgfgdkfkpaigtwdcdtclvqnkpeavkcvacetpkpgtgvkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2k0cA (A:)
    aigtwdcdtclvqnkpeavkcvacetpkpgtgvkr