PDB entry 2k07

View 2k07 on RCSB PDB site
Description: Solution NMR structure of human E2-like ubiquitin-fold modifier conjugating enzyme 1 (UFC1). Northeast Structural Genomics Consortium target HR41
Class: structural genomics, unknown function
Keywords: Ufc1, Ubiquitin Conjugating Enzyme, E2, Ufm1, Polymorphism, Ubl conjugation pathway, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2008-01-25, released 2008-02-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ufm1-conjugating enzyme 1
  Species: Homo sapiens [TaxId:9606]
  Gene: UFC1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y3C8 (0-166)
    • expression tag (167-174)
  Domains in SCOPe 2.05: d2k07a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k07A (A:)
  madeatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnk
  egtrwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdh
  fkplwarnvpkfglahlmalglgpwlaveipdliqkgviqhkekcnqlehhhhhh