PDB entry 2k02

View 2k02 on RCSB PDB site
Description: Solution Structure of Putative Ferrous Iron Transport Protein C (FeoC) of Klebsiella pneumoniae
Class: metal binding protein
Keywords: Ferrous iron transport protein C, FeoC, Klebsiella pneumoniae, Iron-sulfur, Metal-binding, METAL BINDING PROTEIN
Deposited on 2008-01-23, released 2009-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrous iron transport protein C
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:72407]
    Gene: feoC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2k02a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2k02A (A:)
maslmevrdmlalqgrmeakqlsarlqtpqplidamlermeamgkvvrisetsegclsgs
ckscpegkaacrqewwalrlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2k02A (A:)
maslmevrdmlalqgrmeakqlsarlqtpqplidamlermeamgkvvrisetsegclsgs
ckscpegkaacrqewwalr