PDB entry 2k00

View 2k00 on RCSB PDB site
Description: Solution structure of the talin F3 in complex with layilin cytodomain
Class: structural protein
Keywords: structural protein, Cell projection, Cytoplasm, Cytoskeleton, Glycoprotein, Membrane, Phosphoprotein, Alternative splicing, Lectin, Transmembrane
Deposited on 2008-01-23, released 2008-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Talin-1
  Species: GALLUS GALLUS
  Gene: Tln1, Tln
  Database cross-references and differences (RAF-indexed):
  • Uniprot P54939 (0-91)
  Domains in SCOPe 2.07: d2k00a1
• Chain 'B':
  Compound: Layilin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8C351 (0-14)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k00A (A:)
  gvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftl
  dfgdyqdgyysvqttegeqiaqliagyidiil
  

  
  
• Chain 'B':
  No sequence available.