PDB entry 2jzy

View 2jzy on RCSB PDB site
Description: Solution structure of C-terminal effector domain of putative two-component-system response regulator involved in copper resistance from Klebsiella pneumoniae
Class: transcription
Keywords: two-component-system response regulator, effector domain, DNA-binding, Phosphoprotein, Plasmid, Transcription, Transcription regulation, Two-component regulatory system
Deposited on 2008-01-22, released 2009-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-01-27, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulatory protein PcoR
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: pcoR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6U5P9 (1-103)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d2jzya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jzyA (A:)
    maatvctiadmtvdmvrrtvirsgkkihltgkeyvllelllqrtgevlprslisslvwnm
    nfdsdtnvidvavrrlrskidddfepklihtvrgagyvleireelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jzyA (A:)
    maatvctiadmtvdmvrrtvirsgkkihltgkeyvllelllqrtgevlprslisslvwnm
    nfdsdtnvidvavrrlrskidddfepklihtvrgagyvleiree