PDB entry 2jzs

View 2jzs on RCSB PDB site
Description: Solution structure of the reduced form of the N-terminal domain of PilB from N. meningitidis.
Class: electron transport
Keywords: reduced, Neisseria meningitidis, PilB, N-terminal domain, Thioredoxin, Electron transport, Multifunctional enzyme, Oxidoreductase, Redox-active center, Transport
Deposited on 2008-01-15, released 2008-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptide methionine sulfoxide reductase msrA/msrB
  Species: Neisseria meningitidis serogroup A
  Gene: msrAB, pilB
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9JWM8 (1-143)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d2jzsa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jzsA (A:)
  mvphtlstlktadnrpasvylkkdkptlikfwaswcplclselgqtekwaqdakfssanl
  itvaspgflhekkdgdfqkwyaglnypklpvvtdnggtiaqslnisvypswaligkdgdv
  qrivkgsineaqalalirdpnadl