PDB entry 2jza

View 2jza on RCSB PDB site
Description: Solution NMR structure of nitrite reductase [NAD(P)H] small subunit from Erwinia carotovora. Northeast Structural Genomics Consortium target EwR120
Class: oxidoreductase
Keywords: ISP domain, Rieske iron-sulfur protein, 3-layer beta-sandwich, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, nirD, Oxidoreductase
Deposited on 2007-12-31, released 2008-01-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrite reductase [NAD(P)H] small subunit
    Species: Pectobacterium atrosepticum SCRI1043 [TaxId:218491]
    Gene: nirD, ECA4080
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6CZS1 (0-121)
      • expression tag (122-129)
    Domains in SCOPe 2.05: d2jzaa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jzaA (A:)
    msqwttvcklddilpgtgvcalveqqqiavfrprndeqvyaisnidpfaqasvlsrgiva
    ehqddlwvasplkkqhfrlydgfcledgaysvaaydtqvtngnvqisiadsdvavdnsqp
    lplehhhhhh