PDB entry 2jz6

View 2jz6 on RCSB PDB site
Description: Solution structure of 50S ribosomal protein L28 from Thermotoga maritima. Northeast Structural Genomics Consortium target VR97
Class: ribosomal protein
Keywords: Structure, NMR, NESG, Ribonucleoprotein, Ribosomal protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium
Deposited on 2007-12-28, released 2008-01-29
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L28
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: rpm, BTM_0255
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WY96 (5-74)
      • expression tag (0-4)
      • conflict (30)
      • expression tag (75-76)
    Domains in SCOPe 2.02: d2jz6a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jz6A (A:)
    qghmimakrcevcgkaprsgntvshsdkkserwfrpnlqkvrvvlpdgtikrmrvctscl
    ksgkvkkyvgqvsevgs