PDB entry 2jz6

View 2jz6 on RCSB PDB site
Description: Solution structure of 50S ribosomal protein L28 from Thermotoga maritima. Northeast Structural Genomics Consortium target VR97
Class: ribosomal protein
Keywords: NESG, Ribonucleoprotein, Ribosomal protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium
Deposited on 2007-12-28, released 2008-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 50S ribosomal protein L28
  Species: Thermotoga maritima [TaxId:243274]
  Gene: rpm, BTM_0255
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WY96 (5-74)
    • expression tag (0-4)
    • conflict (30)
    • expression tag (75-76)
  Domains in SCOPe 2.08: d2jz6a1, d2jz6a2, d2jz6a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jz6A (A:)
  qghmimakrcevcgkaprsgntvshsdkkserwfrpnlqkvrvvlpdgtikrmrvctscl
  ksgkvkkyvgqvsevgs