PDB entry 2jyo

View 2jyo on RCSB PDB site
Description: NMR Solution structure of Human MIP-3alpha/CCL20
Class: cytokine
Keywords: Protein, Chemokine, Cytokine, Alternative splicing, Antibiotic, Antimicrobial, Chemotaxis, Inflammatory response, Polymorphism, Secreted
Deposited on 2007-12-14, released 2008-01-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-C motif chemokine 20 (Small-inducible cytokine A20) (Macrophage inflammatory protein 3 alpha) (MIP-3-alpha) (Liver and activation-regulated chemokine) (CC chemokine LARC) (Beta chemokine exodus-1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jyoa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jyoA (A:)
    asnfdcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyiv
    rllskkvknm