PDB entry 2jyo

View 2jyo on RCSB PDB site
Description: NMR Solution structure of Human MIP-3alpha/CCL20
Class: cytokine
Keywords: Protein, Chemokine, Cytokine, Alternative splicing, Antibiotic, Antimicrobial, Chemotaxis, Inflammatory response, Polymorphism, Secreted
Deposited on 2007-12-14, released 2008-01-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: C-C motif chemokine 20 (Small-inducible cytokine A20) (Macrophage inflammatory protein 3 alpha) (MIP-3-alpha) (Liver and activation-regulated chemokine) (CC chemokine LARC) (Beta chemokine exodus-1)
  Database cross-references and differences (RAF-indexed):
  • Uniprot P78556 (0-69)
  Domains in SCOPe 2.08: d2jyoa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jyoA (A:)
  asnfdcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyiv
  rllskkvknm