PDB entry 2jyl

View 2jyl on RCSB PDB site
Description: Solution Structure of A Double Mutant of The Carboxy-terminal Dimerization Domain of The HIV-1 Capsid Protein
Class: viral protein
Keywords: HIV-1, Carboxy-terminal, Dimerization domain, CTD, NMR, 3D-NMR, Capsid Protein (CA), double mutant, monomer structure, AIDS, Aspartyl protease, Capsid maturation, Core protein, Cytoplasm, DNA integration, DNA recombination, DNA-directed DNA polymerase, Endonuclease, Hydrolase, Lipoprotein, Magnesium, Membrane, Metal-binding, Multifunctional enzyme, Myristate, Nuclease, Nucleotidyltransferase, Nucleus, Phosphoprotein, Protease, RNA-binding, RNA-directed DNA polymerase, Transferase, Viral nucleoprotein, Virion, Zinc, Zinc-finger, VIRAL PROTEIN
Deposited on 2007-12-14, released 2008-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsid protein p24 (CA)
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (21-104)
      • engineered (57-58)
    Domains in SCOPe 2.07: d2jyla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jylA (A:)
    mgsshhhhhhssglvprgshmtsildirqgpkepfrdyvdrfyktlraeqasqevknaat
    etllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jylA (A:)
    tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
    gatleemmtacqgvggpghkarvl