PDB entry 2jy8

View 2jy8 on RCSB PDB site
Description: NMR structure of the ubiquitin associated (UBA) domain of p62 (SQSTM1) in complex with ubiquitin. RDC refined
Class: protein binding
Keywords: ubiquitin binding, ubiquitin associated domain, helical bundle, three helices, Alternative splicing, Apoptosis, Cytoplasm, Differentiation, Disease mutation, Endosome, Immune response, Metal-binding, Nucleus, Phosphoprotein, Polymorphism, Zinc, Zinc-finger, PROTEIN BINDING
Deposited on 2007-12-07, released 2007-12-18
The last revision prior to the SCOP 1.75 freeze date was dated 2008-03-11, with a file datestamp of 2008-03-07.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-binding protein p62
    Species: HOMO SAPIENS
    Gene: SQSTM1, ORCA, OSIL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13501 (2-51)
      • expression tag (0-1)
    Domains in SCOP 1.75: d2jy8a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jy8A (A:)
    gsppeadprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqyskh