PDB entry 2jy5

View 2jy5 on RCSB PDB site
Description: NMR structure of Ubiquilin 1 UBA domain
Class: signaling protein
Keywords: UBA, Ubiquilin, Alternative splicing, Cytoplasm, Nucleus, Phosphoprotein, Proteasome, SIGNALING PROTEIN
Deposited on 2007-12-06, released 2008-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquilin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBQLN1, DA41, PLIC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UMX0 (5-50)
      • expression tag (0-4)
      • expression tag (51)
    Domains in SCOPe 2.06: d2jy5a1, d2jy5a2, d2jy5a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jy5A (A:)
    gspefqnpevrfqqqleqlsamgflnreanlqaliatggdinaaierllgss