PDB entry 2jxx

View 2jxx on RCSB PDB site
Description: NMR solution structure of Ubiquitin-like domain of NFATC2IP. Northeast Structural Genomics Consortium target HR5627
Class: protein binding
Keywords: Nuclear factor of activated T-cells, cytoplasmic 2-interacting protein, ubiquitin like homologue, NFAT complex, Alternative splicing, Coiled coil, Methylation, Nucleus, Phosphoprotein, Polymorphism, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Structural Genomics Consortium, SGC, PROTEIN BINDING
Deposited on 2007-11-30, released 2007-12-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NFATC2-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene: NFATC2IP, NIP45
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2jxxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2jxxA (A:)
mgsshhhhhhssglvprgstetsqqlqlrvqgkekhqtlevslsrdsplktlmshyeeam
glsgrklsfffdgtklsgrelpadlgmesgdlievwg

    Sequence, based on observed residues (ATOM records): (download) 
    >2jxxA (A:)
tetsqqlqlrvqgkekhqtlevslsrdsplktlmshyeeamglsgrklsfffdgtklsgr
elpadlgmesgdlievwg