PDB entry 2jxm

View 2jxm on RCSB PDB site
Description: Ensemble of twenty structures of the Prochlorothrix hollandica plastocyanin- cytochrome f complex
Class: electron transport
Keywords: Copper, Electron transport, Metal-binding, Transport
Deposited on 2007-11-22, released 2008-02-12
The last revision prior to the SCOP 1.75 freeze date was dated 2008-02-19, with a file datestamp of 2008-02-15.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plastocyanin
    Species: Prochlorothrix hollandica
    Gene: PETE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50057 (0-96)
      • engineered (1)
    Domains in SCOP 1.75: d2jxma1
  • Chain 'B':
    Compound: cytochrome f
    Species: Prochlorothrix hollandica
    Gene: PETA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2jxmb1
  • Heterogens: CU, HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jxmA (A:)
asvqikmgtdkyaplyepkalsisagdtvefvmnkvgphnvifdkvpagesapalsntkl
aiapgsfysvtlgtpgtysfyctphrgagmvgtitve

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jxmB (B:)
ypfyaqynydspreatgkivcanchlakktveievpqavlpdtvfkavvkvpydldiqqv
qadgspsglnvgavlmlpegfklappervdeelmeevgdfyylvtpysetdenillagpl
pgedyqemifpilspnpatdagvyfgkysihlggnrgrgqvyptgelsnnnafsasiagt
iaaiedngfgfdvtiqpedgdavvtsilpgpelivavgdtveagqllttnpnvggfgqmd
seivlqsss