PDB entry 2jxh

View 2jxh on RCSB PDB site
Description: Solution Structure of DNA binding domain of Proline Utilization A (PutA) for Psuedomonas putida
Class: DNA binding protein
Keywords: PutA, Proline, Utilization, DNA, binding, DNA BINDING PROTEIN
Deposited on 2007-11-19, released 2008-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-10, with a file datestamp of 2009-02-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: proline dehydrogenase
  Species: Pseudomonas putida [TaxId:303]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9R9T7
  Domains in SCOPe 2.08: d2jxha_
• Chain 'B':
  Compound: proline dehydrogenase
  Species: Pseudomonas putida [TaxId:303]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9R9T7 (0-44)
  Domains in SCOPe 2.08: d2jxhb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jxhA (A:)
  matttlgvklddptrerlkaaaqsidrtphwlikqaifnylekle
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jxhB (B:)
  matttlgvklddptrerlkaaaqsidrtphwlikqaifnylekle