PDB entry 2jxd

View 2jxd on RCSB PDB site
Description: NMR structure of human Serine protease inhibitor Kazal type II (SPINK2)
Class: hydrolase inhibitor
Keywords: anti-parallel beta sheet, beta-bulge, disulfide bond, alpha helix, Protease inhibitor, Pyrrolidone carboxylic acid, Secreted, Serine protease inhibitor, HYDROLASE INHIBITOR
Deposited on 2007-11-15, released 2008-11-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-02-09, with a file datestamp of 2010-02-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine protease inhibitor Kazal-type 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SPINK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jxda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jxdA (A:)
    pqfglfskyrtpncsqyrlpgcprhfnpvcgsdmstyanectlcmkiregghnikiirng
    pc