PDB entry 2jwz

View 2jwz on RCSB PDB site
Description: Mutations in the hydrophobic core of ubiquitin differentially affect its recognition by receptor proteins
Class: signaling protein
Keywords: UBIQUITIN, NMR, L69S MUTANT, CORE MUTATION, Cytoplasm, DNA damage, DNA repair, Nucleus, Phosphorylation, Ubl conjugation, PROTEASOMAL DEGRADATION, SIGNALING PROTEIN
Deposited on 2007-10-31, released 2008-01-08
The last revision prior to the SCOP 1.75 freeze date was dated 2008-01-08, with a file datestamp of 2008-01-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: SACCHAROMYCES CEREVISIAE
    Gene: UBI1, RPL40A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61864 (0-75)
      • engineered (68)
    Domains in SCOP 1.75: d2jwza1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jwzA (A:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhsvlrlrgg