PDB entry 2jww

View 2jww on RCSB PDB site
Description: Calcium-free rat alpha-parvalbumin
Class: metal binding protein
Keywords: alpha-parvalbumin, EF-hand protein, calcium-free, Acetylation, Muscle protein, Phosphorylation, METAL BINDING PROTEIN
Deposited on 2007-10-25, released 2008-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: parvalbumin alpha
    Species: Rattus norvegicus
    Gene: PVALB, PVA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jwwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jwwA (A:)
    smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
    delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes