PDB entry 2jwo

View 2jwo on RCSB PDB site
Description: A PHD finger motif in the C-terminus of RAG2 modulates recombination activity
Class: recombination
Keywords: V(D)J recombination, phosphoinositide signaling, RAG2, PHD domain, DNA recombination, DNA-binding, Endonuclease, Hydrolase, Nuclease, Nucleus
Deposited on 2007-10-17, released 2007-11-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: V(D)J recombination-activating protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: Rag2, Rag-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21784 (8-81)
      • expression tag (0-7)
    Domains in SCOPe 2.08: d2jwoa1, d2jwoa2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jwoA (A:)
gplgspefgywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleert
lihlsegsnkyycnehvqiara