PDB entry 2jwd

View 2jwd on RCSB PDB site
Description: protein A
Class: immune system
Keywords: protein a, poly glutamine, Cell wall, IgG-binding protein, Peptidoglycan-anchor, Secreted, IMMUNE SYSTEM
Deposited on 2007-10-09, released 2008-10-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38507 (2-58)
      • expression tag (0-1)
      • engineered (14)
    Domains in SCOPe 2.03: d2jwda1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jwdA (A:)
    dvdnkfnkeqqnafweilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqapk