PDB entry 2jw6

View 2jw6 on RCSB PDB site
Description: Solution structure of the DEAF1 MYND domain
Class: transcription
Keywords: zinc binding domain, transcription, Disease mutation, DNA-binding, Metal-binding, Nucleus, Phosphorylation, Secreted, Transcription regulation, Zinc-finger
Deposited on 2007-10-08, released 2007-12-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Deformed epidermal autoregulatory factor 1 homolog
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75398 (Start-51)
  Domains in SCOPe 2.08: d2jw6a_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2jw6A (A:)
  gamdaerkeqscvncgreamsectgchkvnycstfcqrkdwkdhqhicgqsa
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2jw6A (A:)
  scvncgreamsectgchkvnycstfcqrkdwkdhqhicgqsa