PDB entry 2jvv

View 2jvv on RCSB PDB site
Description: Solution Structure of E. coli NusG carboxyterminal domain
Class: transcription
Keywords: NusG, transcription factor, Transcription antitermination, Transcription regulation, Transcription termination, TRANSCRIPTION
Deposited on 2007-09-26, released 2008-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription antitermination protein nusG
    Species: Escherichia coli [TaxId:562]
    Gene: NusG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2jvva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2jvvA (A:)
mseapkkrwyvvqafsgfegrvatslrehiklhnmedlfgevmvpteevveirggqrrks
erkffpgyvlvqmvmndaswhlvrsvprvmgfiggtsdrpapisdkevdaimnrlqqvgd
kprpktlfepgemvrvndgpfadfngvveevdyeksrlkvsvsifgratpveldfsqvek
a

    Sequence, based on observed residues (ATOM records): (download) 
    >2jvvA (A:)
rpktlfepgemvrvndgpfadfngvveevdyeksrlkvsvsifgratpveldfsqveka