PDB entry 2jvj

View 2jvj on RCSB PDB site
Description: NMR Solution Structure of the Hyper-Sporulation Response Regulator Spo0F Mutant I90A from Bacillus subtilis
Class: transferase
Keywords: RESPONSE REGULATOR, TWO-COMPONENT SYSTEMS, BACTERIAL SIGNAL TRANSDUCTION, PHOSPHO-RELAY, (BETA/ALPHA)5 PROTEIN, Cytoplasm, Kinase, Magnesium, Metal-binding, Phosphorylation, Sporulation, Transferase, Two-component regulatory system
Deposited on 2007-09-20, released 2008-02-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sporulation initiation phosphotransferase f
  Species: Bacillus subtilis [TaxId:1423]
  Gene: SPO0F
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06628 (0-123)
    • engineered (89)
    • expression tag (124-131)
  Domains in SCOPe 2.05: d2jvja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jvjA (A:)
  mmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
  dgieilkrmkvidenirviimtaygeldmaqeskelgalthfakpfdideirdavkkylp
  lksnlehhhhhh