PDB entry 2jvc

View 2jvc on RCSB PDB site
Description: NMR solution structure of ubiquitin like protein
Class: unknown function
Keywords: ubiquitin, UNKNOWN FUNCTION
Deposited on 2007-09-17, released 2008-10-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ubiquitin_like protein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2JVC (0-81)
  Domains in SCOPe 2.01: d2jvca1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jvcA (A:)
  gplgsmqifvktltgktitidvdhadtvgavkakiydkegippdqqrlifggkqledsna
  msdynvqkestlhlvlrlrggv