PDB entry 2jv6

View 2jv6 on RCSB PDB site
Description: YF ED3 Protein NMR Structure
Class: viral protein
Keywords: Yellow Fever, Envelop Protein Domain III, Flavivirus, ATP-binding, Capsid protein, Cleavage on pair of basic residues, Endoplasmic reticulum, Envelope protein, Glycoprotein, Helicase, Hydrolase, Membrane, Metal-binding, Multifunctional enzyme, Nucleotide-binding, Nucleotidyltransferase, Nucleus, Phosphorylation, Protease, Ribonucleoprotein, RNA replication, RNA-binding, RNA-directed RNA polymerase, Secreted, Serine protease, Transferase, Transmembrane, Viral nucleoprotein, Virion, VIRAL PROTEIN
Deposited on 2007-09-12, released 2008-09-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Envelope protein E
  Species: Yellow fever virus [TaxId:11089]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6J3P1 (1-111)
    • initiating methionine (0)
  Domains in SCOPe 2.05: d2jv6a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jv6A (A:)
  msaltlkgtsykmctdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaaink
  gilvtvnpiastnddevlievnppfgdsyiivgtgdsrltyqwhkegssigk