PDB entry 2jv1

View 2jv1 on RCSB PDB site
Description: NMR structure of human insulin monomer in 35% CD3CN zinc free, 50 structures
Class: hormone
Keywords: NMR, Human Insulin, 35% CD3CN, Monomer, Carbohydrate metabolism, Cleavage on pair of basic residues, Diabetes mellitus, Disease mutation, Glucose metabolism, Hormone, Pharmaceutical, Secreted
Deposited on 2007-09-11, released 2007-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'B':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Gene: INS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOPe 2.08: d2jv1b1

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jv1B (B:)
  fvnqhlcgshlvealylvcgergffytpkt