PDB entry 2juz

View 2juz on RCSB PDB site
Description: Solution NMR structure of HI0947 from Haemophilus influenzae, Northeast Structural Genomics Consortium Target IR123
Class: structural genomics, unknown function
Keywords: homodimer, helix, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2007-09-09, released 2007-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0352 protein HI0840
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI0840
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44897 (0-71)
      • expression tag (72-79)
    Domains in SCOPe 2.08: d2juza1, d2juza2
  • Chain 'B':
    Compound: UPF0352 protein HI0840
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI0840
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44897 (0-71)
      • expression tag (72-79)
    Domains in SCOPe 2.08: d2juzb2, d2juzb3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2juzA (A:)
maqhskysdaqlsaivndmiavlekhkapvdlslialgnmasnllttsvpqtqcealaqa
fsnslinavktrlehhhhhh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2juzB (B:)
maqhskysdaqlsaivndmiavlekhkapvdlslialgnmasnllttsvpqtqcealaqa
fsnslinavktrlehhhhhh