PDB entry 2juw

View 2juw on RCSB PDB site
Description: NMR solution structure of homodimer protein SO_2176 from Shewanella oneidensis. Northeast Structural Genomics Consortium target SoR77
Class: structural genomics, unknown function
Keywords: homodimer, helix, dimer, all alpha, Northeast Structural Genomics Consortium, NESG, STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI-2, Protein Structure Initiative
Deposited on 2007-09-03, released 2007-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0352 protein SO_2176
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: SO_2176
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EF26 (0-71)
      • expression tag (72-79)
    Domains in SCOPe 2.07: d2juwa1, d2juwa2
  • Chain 'B':
    Compound: UPF0352 protein SO_2176
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: SO_2176
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EF26 (0-71)
      • expression tag (72-79)
    Domains in SCOPe 2.07: d2juwb2, d2juwb3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2juwA (A:)
    maiqskysntqvesliaeilvvlekhkaptdlslmalgncvthllerkvpsesrqavaeq
    fakalaqsvksnlehhhhhh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2juwB (B:)
    maiqskysntqvesliaeilvvlekhkaptdlslmalgncvthllerkvpsesrqavaeq
    fakalaqsvksnlehhhhhh