PDB entry 2juv

View 2juv on RCSB PDB site
Description: AbaA3-DKP-insulin
Class: hormone
Keywords: insulin, NMR, Aba, Carbohydrate metabolism, Cleavage on pair of basic residues, Diabetes mellitus, Disease mutation, Glucose metabolism, Hormone, Pharmaceutical, Secreted
Deposited on 2007-09-05, released 2007-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin A chain
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
    • engineered (2)
• Chain 'B':
  Compound: insulin B chain
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
    • engineered (9)
    • engineered (27-28)
  Domains in SCOPe 2.08: d2juvb1

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2juvB (B:)
  fvnqhlcgsdlvealylvcgergffytkpt