PDB entry 2jum

View 2jum on RCSB PDB site
Description: ThrA3-DKP-insulin
Class: hormone
Keywords: insulin, NMR, ThrA3, Carbohydrate metabolism, Cleavage on pair of basic residues, Diabetes mellitus, Disease mutation, Glucose metabolism, Hormone, Pharmaceutical, Secreted
Deposited on 2007-08-31, released 2007-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin A chain
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-20)
      • engineered (2)
  • Chain 'B':
    Compound: insulin B chain
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-29)
      • engineered (9)
      • engineered (27-28)
    Domains in SCOPe 2.08: d2jumb1

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jumB (B:)
    fvnqhlcgsdlvealylvcgergffytkpt