PDB entry 2juf

View 2juf on RCSB PDB site
Description: NMR solution structure of PARC CPH Domain. NESG Target HR3443B/SGC-Toronto
Class: gene regulation
Keywords: CPH domain, Structural Genomics Consortium, SGC, Northeast Structural Genomics Consortium, NESG, Alternative splicing, ATP-binding, Coiled coil, Cytoplasm, Metal-binding, Nucleotide-binding, Ubl conjugation, Ubl conjugation pathway, Zinc, Zinc-finger, PSI-2, Protein Structure Initiative, GENE REGULATION
Deposited on 2007-08-23, released 2007-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p53-associated parkin-like cytoplasmic protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PARC, H7AP1, KIAA0708
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2jufa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2jufA (A:)
gshmrsefssrggygeyvqqtlqpgmrvrmlddyeeisagdegefrqsnngippvqvfwq
stgrtywvhwhmleilgpeeatedkasaavekgagatvlgtafps

    Sequence, based on observed residues (ATOM records): (download) 
    >2jufA (A:)
ygeyvqqtlqpgmrvrmlddyeeisagdegefrqsnngippvqvfwqstgrtywvhwhml
eilg