PDB entry 2jua

View 2jua on RCSB PDB site
Description: Assignment, structure, and dynamics of de novo designed protein S836
Class: de novo protein
Keywords: de novo protein
Deposited on 2007-08-16, released 2008-05-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: de novo protein S836
    Species: unidentified
    Database cross-references and differences (RAF-indexed):
    • PDB 2JUA (0-101)
    Domains in SCOPe 2.06: d2juaa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2juaA (A:)
    mygklndlledlqevlkhvnqhwqggqknmnkvdhhlqnviedihdfmqgggsggklqem
    mkefqqvldeikqqlqggdnslhnvhenikeifhhleelvhr