PDB entry 2jtz

View 2jtz on RCSB PDB site
Description: Solution structure and chemical shift assignments of the F104-to-5-flurotryptophan mutant of cardiac troponin C
Class: contractile protein
Keywords: EF-hand protein, Calcium-binding protein, Phe-to-Trp mutation, Acetylation, Muscle protein, Polymorphism, CONTRACTILE PROTEIN
Deposited on 2007-08-10, released 2007-08-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNC1, TNNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316 (0-160)
      • engineered (34)
      • engineered (83)
      • engineered (103)
    Domains in SCOPe 2.06: d2jtza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jtzA (A:)
mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmwdknadgyidldelkim
lqatgetiteddieelmkdgdknndgridydeflefmkgve