PDB entry 2jtg

View 2jtg on RCSB PDB site
Description: Solution structure of the THAP-zinc finger of THAP1
Class: metal binding protein
Keywords: THAP, zinc finger, CCCH, DNA-binding, Metal-binding, Zinc-finger, METAL BINDING PROTEIN
Deposited on 2007-07-31, released 2007-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: THAP domain-containing protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: THAP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NVV9 (0-80)
    • expression tag (81-86)
  Domains in SCOPe 2.07: d2jtga1, d2jtga2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jtgA (A:)
  mvqscsaygcknrydkdkpvsfhkfpltrpslckeweaavrrknfkptkyssicsehftp
  dcfkrecnnkllkenavptiflelvpr