PDB entry 2jte

View 2jte on RCSB PDB site
Description: Third SH3 domain of CD2AP
Class: signaling protein
Keywords: protein, SH3 domain, Coiled coil, Cytoplasm, Phosphorylation, SH3-binding, SIGNALING PROTEIN
Deposited on 2007-07-28, released 2007-12-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD2-associated protein
    Species: Mus musculus [TaxId:10090]
    Gene: Cd2ap, Mets1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLQ0 (4-63)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d2jtea1, d2jtea2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jteA (A:)
    gamgakeycrtlfpytgtnedeltfregeiihlisketgeagwwkgelngkegvfpdnfa
    vqis