PDB entry 2jt5

View 2jt5 on RCSB PDB site
Description: solution structure of matrix metalloproteinase 3 (MMP-3) in the presence of n-hydroxy-2-[n-(2-hydroxyethyl)biphenyl-4-sulfonamide] hydroxamic acid (MLC88)
Class: hydrolase
Keywords: metalloproteinase, MMP, Calcium, Collagen degradation, Extracellular matrix, Glycoprotein, Hydrolase, Metal-binding, Metalloprotease, Polymorphism, Protease, Zinc, Zymogen
Deposited on 2007-07-20, released 2008-02-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stromelysin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP3, STMY1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2jt5a_
  • Heterogens: ZN, CA, JT5

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jt5A (A:)
    gipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimisfa
    vrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaaheighsl
    glfhsantealmyplyhsltdltrfrlsqddingiqslygp