PDB entry 2jss

View 2jss on RCSB PDB site
Description: NMR structure of chaperone Chz1 complexed with histone H2A.Z-H2B
Class: Chaperone/Nuclear Protein
Keywords: Histone/chaperone complex, intrinsically unfolded protein, Chaperone/Structural Protein COMPLEX, Chaperone/Nuclear Protein COMPLEX
Deposited on 2007-07-11, released 2008-05-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chimera of Histone H2B.1 and Histone H2A.Z
    Species: Saccharomyces cerevisiae
    Gene: HTB1, H2B1, SPT12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2jssa1, d2jssa2
  • Chain 'B':
    Compound: Uncharacterized protein YER030W
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jssA (A:)
    rketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisar
    eiqtavrlilpgelakhavsegtravtkyssstqaqsssaraglqfpvgrikrylkrhat
    grtrvgskaaiyltavleyltaevlelagnaakdlkvkritprhlqlairgddeldslir
    atiasggvlphi
    

  • Chain 'B':
    No sequence available.