PDB entry 2jsf

View 2jsf on RCSB PDB site
Description: Solution structures of the envelope protein domain III from the dengue-2 virus
Class: viral protein
Keywords: Domain III, VIRAL PROTEIN
Deposited on 2007-07-03, released 2008-05-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: domain III of ENVELOPE PROTEIN E
    Species: Dengue virus [TaxId:11060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18356 (0-108)
      • expression tag (109-116)
    Domains in SCOPe 2.08: d2jsfa2, d2jsfa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jsfA (A:)
    mdklqlkgmsysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvl
    grlitvnpivtekdspvnieaeppfgdsyiiigvepgqlklnwfkkgsslehhhhhh