PDB entry 2jsd

View 2jsd on RCSB PDB site
Description: Solution structure of MMP20 complexed with NNGH
Class: hydrolase
Keywords: MMP-NNGH, Structural Genomics, Structural Proteomics in Europe, SPINE, SPINE-2, SPINE2-COMPLEXES, HYDROLASE
Deposited on 2007-07-03, released 2007-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrix metalloproteinase-20
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP20
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jsda_
  • Heterogens: CA, ZN, NGH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jsdA (A:)
    gepkwkkntltyriskytpsmssvevdkavemalqawssavplsfvrinsgeadimisfe
    ngdhgdsypfdgprgtlahafapgeglggdthfdnaekwtmgtngfnlftvaahefghal
    glahstdpsalmyptykyknpygfhlpkddvkgiqalygp