PDB entry 2js7

View 2js7 on RCSB PDB site
Description: Solution NMR structure of human myeloid differentiation primary response (MyD88). Northeast Structural Genomics target HR2869A
Class: signaling protein
Keywords: MYD88_HUMAN, TIR DOMAIN, TOLL LIKE RECEPTOR ADAPTOR DOMAIN, innate immune signaling, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, SIGNALING PROTEIN
Deposited on 2007-06-29, released 2007-10-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myeloid differentiation primary response protein MyD88
    Species: Homo sapiens [TaxId:9606]
    Gene: MYD88
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99836 (1-151)
      • expression tag (0)
      • expression tag (152-159)
    Domains in SCOPe 2.08: d2js7a1, d2js7a2, d2js7a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2js7A (A:)
    mgittlddplghmperfdaficycpsdiqfvqemirqleqtnyrlklcvsdrdvlpgtcv
    wsiaseliekrcrrmvvvvsddylqskecdfqtkfalslspgahqkrlipikykamkkef
    psilrfitvcdytnpctkswfwtrlakalslplehhhhhh