PDB entry 2js1

View 2js1 on RCSB PDB site
Description: Solution NMR structure of the homodimer protein YVFG from Bacillus subtilis, Northeast Structural Genomics Consortium Target SR478
Class: structural genomics, unknown function
Keywords: helical bundle, homodimer, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2007-06-29, released 2007-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein yvfG
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yvfG, BSU34210
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71066 (0-71)
      • expression tag (72-79)
    Domains in SCOPe 2.08: d2js1a2, d2js1a3
  • Chain 'B':
    Compound: Uncharacterized protein yvfG
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yvfG, BSU34210
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71066 (0-71)
      • expression tag (72-79)
    Domains in SCOPe 2.08: d2js1b2, d2js1b3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2js1A (A:)
mselfsvpyfienlkqhiemnqsedkihamnsyyrsvvstlvqdqltknavvlkriqhld
eaynkvkrgesklehhhhhh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2js1B (B:)
mselfsvpyfienlkqhiemnqsedkihamnsyyrsvvstlvqdqltknavvlkriqhld
eaynkvkrgesklehhhhhh