PDB entry 2jrz

View 2jrz on RCSB PDB site
Description: Solution structure of the Bright/ARID domain from the human JARID1C protein.
Class: oxidoreductase
Keywords: JARID1C, Bright/ARID domain, helical, Structural Genomics, Structural Genomics Consortium, SGC, OXIDOREDUCTASE
Deposited on 2007-06-29, released 2007-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Histone demethylase JARID1C
  Species: Homo sapiens [TaxId:9606]
  Gene: JARID1C, DXS1272E, SMCX, XE169
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41229 (2-116)
    • cloning artifact (0-1)
  Domains in SCOPe 2.08: d2jrza1, d2jrza2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jrzA (A:)
  smneleaqtrvklnyldqiakfweiqgsslkipnverrildlyslskivveeggyeaick
  drrwarvaqrlnyppgknigsllrshyerivypyemyqsganlvcntrpfdneekdk