PDB entry 2jrz

View 2jrz on RCSB PDB site
Description: Solution structure of the Bright/ARID domain from the human JARID1C protein.
Class: oxidoreductase
Keywords: JARID1C, Bright/ARID domain, helical, Structural Genomics, Structural Genomics Consortium, SGC, OXIDOREDUCTASE
Deposited on 2007-06-29, released 2007-07-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-18, with a file datestamp of 2009-08-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone demethylase JARID1C
    Species: Homo sapiens [TaxId:9606]
    Gene: JARID1C, DXS1272E, SMCX, XE169
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41229 (2-116)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d2jrza1, d2jrza2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jrzA (A:)
    smneleaqtrvklnyldqiakfweiqgsslkipnverrildlyslskivveeggyeaick
    drrwarvaqrlnyppgknigsllrshyerivypyemyqsganlvcntrpfdneekdk