PDB entry 2jrx

View 2jrx on RCSB PDB site
Description: Solution NMR structure of protein YejL from E. coli. Northeast Structural Genomics target ER309
Class: structural genomics, unknown function
Keywords: homodimer, alpha helix, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2007-06-29, released 2007-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0352 protein yejL
    Species: Escherichia coli [TaxId:83333]
    Gene: yejL, b2187, JW2175
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AD24 (0-74)
      • cloning artifact (75-82)
    Domains in SCOPe 2.07: d2jrxa1, d2jrxa2
  • Chain 'B':
    Compound: UPF0352 protein yejL
    Species: Escherichia coli [TaxId:83333]
    Gene: yejL, b2187, JW2175
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AD24 (0-74)
      • cloning artifact (75-82)
    Domains in SCOPe 2.07: d2jrxb2, d2jrxb3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jrxA (A:)
    mpqisrysdeqveqllaellnvlekhkaptdlslmvlgnmvtnlintsiapaqrqaians
    faralqssinedkahlehhhhhh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jrxB (B:)
    mpqisrysdeqveqllaellnvlekhkaptdlslmvlgnmvtnlintsiapaqrqaians
    faralqssinedkahlehhhhhh